Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for Mohambone 81. Mohambone Lv 1 13 pts. 8,668
  2. Avatar for pizpot 82. pizpot Lv 1 12 pts. 8,664
  3. Avatar for pvc78 83. pvc78 Lv 1 12 pts. 8,662
  4. Avatar for smholst 84. smholst Lv 1 11 pts. 8,659
  5. Avatar for Superphosphate 85. Superphosphate Lv 1 11 pts. 8,655
  6. Avatar for ViJay7019 86. ViJay7019 Lv 1 11 pts. 8,648
  7. Avatar for t012 87. t012 Lv 1 10 pts. 8,638
  8. Avatar for NameChangeNeeded01 88. NameChangeNeeded01 Lv 1 10 pts. 8,636
  9. Avatar for Giant Berk 89. Giant Berk Lv 1 10 pts. 8,623
  10. Avatar for hansvandenhof 90. hansvandenhof Lv 1 9 pts. 8,621

Comments