Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830
  1. Avatar for Mohambone 81. Mohambone Lv 1 13 pts. 8,668
  2. Avatar for pizpot 82. pizpot Lv 1 12 pts. 8,664
  3. Avatar for pvc78 83. pvc78 Lv 1 12 pts. 8,662
  4. Avatar for smholst 84. smholst Lv 1 11 pts. 8,659
  5. Avatar for Superphosphate 85. Superphosphate Lv 1 11 pts. 8,655
  6. Avatar for ViJay7019 86. ViJay7019 Lv 1 11 pts. 8,648
  7. Avatar for t012 87. t012 Lv 1 10 pts. 8,638
  8. Avatar for NameChangeNeeded01 88. NameChangeNeeded01 Lv 1 10 pts. 8,636
  9. Avatar for Giant Berk 89. Giant Berk Lv 1 10 pts. 8,623
  10. Avatar for hansvandenhof 90. hansvandenhof Lv 1 9 pts. 8,621

Comments