Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830
  1. Avatar for inkycatz 201. inkycatz Lv 1 1 pt. 6,810
  2. Avatar for BCAA 202. BCAA Lv 1 1 pt. 6,784
  3. Avatar for FRANKY3553 203. FRANKY3553 Lv 1 1 pt. 6,773
  4. Avatar for AryehK 204. AryehK Lv 1 1 pt. 6,463
  5. Avatar for JoonatanKorhonen 205. JoonatanKorhonen Lv 1 1 pt. 6,415
  6. Avatar for gmar 206. gmar Lv 1 1 pt. 6,410
  7. Avatar for Ronin-Sensei 207. Ronin-Sensei Lv 1 1 pt. 6,344
  8. Avatar for doctaven 208. doctaven Lv 1 1 pt. 6,269
  9. Avatar for FreeFolder 209. FreeFolder Lv 1 1 pt. 6,239
  10. Avatar for johngran 210. johngran Lv 1 1 pt. 6,229

Comments