Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830

  1. Avatar for Bogdan at work 211. Bogdan at work Lv 1 1 pt. 6,115
  2. Avatar for powerbicu 212. powerbicu Lv 1 1 pt. 6,098
  3. Avatar for donigiewicz 213. donigiewicz Lv 1 1 pt. 5,991
  4. Avatar for aspadistra 214. aspadistra Lv 1 1 pt. 5,956
  5. Avatar for mir000 215. mir000 Lv 1 1 pt. 5,931
  6. Avatar for Cyrussitu 216. Cyrussitu Lv 1 1 pt. 5,889
  7. Avatar for The Toaster 217. The Toaster Lv 1 1 pt. 5,717
  8. Avatar for Aldrovanda 218. Aldrovanda Lv 1 1 pt. 5,649
  9. Avatar for Pyotr 219. Pyotr Lv 1 1 pt. 5,541
  10. Avatar for Voltozan 220. Voltozan Lv 1 1 pt. 5,326

Comments