Placeholder image of a protein
Icon representing a puzzle

1181: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,774
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 8,733
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,690
  4. Avatar for freefolder 14. freefolder 1 pt. 8,601
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 8,589
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,534
  7. Avatar for Deleted group 17. Deleted group pts. 7,638
  8. Avatar for uneRx 18. uneRx 1 pt. 7,617
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,452
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,214

  1. Avatar for senor pit 141. senor pit Lv 1 2 pts. 8,354
  2. Avatar for Iron pet 142. Iron pet Lv 1 2 pts. 8,345
  3. Avatar for GreekCivilization 143. GreekCivilization Lv 1 2 pts. 8,335
  4. Avatar for dbuske 144. dbuske Lv 1 2 pts. 8,334
  5. Avatar for Festering Wounds 145. Festering Wounds Lv 1 2 pts. 8,330
  6. Avatar for bendbob 146. bendbob Lv 1 2 pts. 8,330
  7. Avatar for Mydogisa Toelicker 147. Mydogisa Toelicker Lv 1 1 pt. 8,329
  8. Avatar for PrettyPony2001 148. PrettyPony2001 Lv 1 1 pt. 8,328
  9. Avatar for asperger1993 149. asperger1993 Lv 1 1 pt. 8,324
  10. Avatar for Soggy Doglog 150. Soggy Doglog Lv 1 1 pt. 8,312

Comments