Placeholder image of a protein
Icon representing a puzzle

1183: Unsolved De-novo Freestyle 65

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 15, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,766
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,750
  3. Avatar for Contenders 3. Contenders 56 pts. 9,666
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,616
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,558
  6. Avatar for Go Science 6. Go Science 20 pts. 9,534
  7. Avatar for HMT heritage 7. HMT heritage 14 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,443
  9. Avatar for Deleted group 9. Deleted group pts. 9,377
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 4 pts. 9,370

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,763
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 98 pts. 9,743
  3. Avatar for jermainiac 3. jermainiac Lv 1 96 pts. 9,727
  4. Avatar for bertro 4. bertro Lv 1 94 pts. 9,662
  5. Avatar for Mark- 5. Mark- Lv 1 92 pts. 9,654
  6. Avatar for Deleted player 6. Deleted player pts. 9,639
  7. Avatar for Susume 7. Susume Lv 1 88 pts. 9,597
  8. Avatar for Blipperman 8. Blipperman Lv 1 86 pts. 9,591
  9. Avatar for KarenCH 9. KarenCH Lv 1 84 pts. 9,580
  10. Avatar for gmn 10. gmn Lv 1 82 pts. 9,566

Comments


decahedron Lv 1

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep Staff Lv 1

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.