Placeholder image of a protein
Icon representing a puzzle

1183: Unsolved De-novo Freestyle 65

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 15, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 9,136
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,088
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,059
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,044
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,892
  6. Avatar for freefolder 16. freefolder 1 pt. 8,296
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,226
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,850
  9. Avatar for CureCoin 19. CureCoin 1 pt. 5,675
  1. Avatar for demeter900 161. demeter900 Lv 1 1 pt. 7,637
  2. Avatar for NotJim99 162. NotJim99 Lv 1 1 pt. 7,635
  3. Avatar for Graham MF 163. Graham MF Lv 1 1 pt. 7,632
  4. Avatar for mega020 164. mega020 Lv 1 1 pt. 7,573
  5. Avatar for jbmkfm125 165. jbmkfm125 Lv 1 1 pt. 7,528
  6. Avatar for onakanta4 166. onakanta4 Lv 1 1 pt. 7,495
  7. Avatar for Jaco van As 167. Jaco van As Lv 1 1 pt. 7,484
  8. Avatar for Khazgrim 168. Khazgrim Lv 1 1 pt. 7,463
  9. Avatar for Philippe_C 169. Philippe_C Lv 1 1 pt. 7,381
  10. Avatar for marie.c 170. marie.c Lv 1 1 pt. 7,344

Comments

decahedron Lv 1

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep Staff Lv 1

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.