Placeholder image of a protein
Icon representing a puzzle

1183: Unsolved De-novo Freestyle 65

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 15, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 9,136
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,088
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,059
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,044
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,892
  6. Avatar for freefolder 16. freefolder 1 pt. 8,296
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,226
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,850
  9. Avatar for CureCoin 19. CureCoin 1 pt. 5,675
  1. Avatar for shell7 171. shell7 Lv 1 1 pt. 7,323
  2. Avatar for Close At Hand 172. Close At Hand Lv 1 1 pt. 7,289
  3. Avatar for ntduong555 173. ntduong555 Lv 1 1 pt. 7,230
  4. Avatar for doctaven 174. doctaven Lv 1 1 pt. 7,226
  5. Avatar for MysticRogue6 175. MysticRogue6 Lv 1 1 pt. 7,204
  6. Avatar for tsarsaltin 176. tsarsaltin Lv 1 1 pt. 7,193
  7. Avatar for avidrockclimber2 177. avidrockclimber2 Lv 1 1 pt. 7,176
  8. Avatar for MaartenDesnouck 178. MaartenDesnouck Lv 1 1 pt. 7,133
  9. Avatar for arcdadius113 179. arcdadius113 Lv 1 1 pt. 7,102
  10. Avatar for sauvesean 180. sauvesean Lv 1 1 pt. 7,083

Comments

decahedron Lv 1

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep Staff Lv 1

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.