Placeholder image of a protein
Icon representing a puzzle

1183: Unsolved De-novo Freestyle 65

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 15, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 9,136
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,088
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,059
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,044
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,892
  6. Avatar for freefolder 16. freefolder 1 pt. 8,296
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,226
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,850
  9. Avatar for CureCoin 19. CureCoin 1 pt. 5,675

  1. Avatar for aspadistra 201. aspadistra Lv 1 1 pt. 5,850
  2. Avatar for Blitzghost 202. Blitzghost Lv 1 1 pt. 5,802
  3. Avatar for frostschutz 203. frostschutz Lv 1 1 pt. 5,746
  4. Avatar for ninome 204. ninome Lv 1 1 pt. 5,678
  5. Avatar for smarthuman 205. smarthuman Lv 1 1 pt. 5,675
  6. Avatar for FreeFolder 206. FreeFolder Lv 1 1 pt. 5,670
  7. Avatar for SWR_DMaster 207. SWR_DMaster Lv 1 1 pt. 5,583
  8. Avatar for brgreening 208. brgreening Lv 1 1 pt. 5,531
  9. Avatar for Stabbi 209. Stabbi Lv 1 1 pt. 5,412
  10. Avatar for Bogdan at work 210. Bogdan at work Lv 1 1 pt. 5,405

Comments


decahedron Lv 1

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep Staff Lv 1

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.