Placeholder image of a protein
Icon representing a puzzle

1183: Unsolved De-novo Freestyle 65

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 15, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 9,136
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,088
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,059
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,044
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,892
  6. Avatar for freefolder 16. freefolder 1 pt. 8,296
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,226
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,850
  9. Avatar for CureCoin 19. CureCoin 1 pt. 5,675
  1. Avatar for gloverd 31. gloverd Lv 1 50 pts. 9,415
  2. Avatar for diamond_dust 32. diamond_dust Lv 1 49 pts. 9,408
  3. Avatar for LociOiling 33. LociOiling Lv 1 47 pts. 9,394
  4. Avatar for Anfinsen_slept_here 34. Anfinsen_slept_here Lv 1 46 pts. 9,377
  5. Avatar for deLaCeiba 35. deLaCeiba Lv 1 45 pts. 9,370
  6. Avatar for Madde 36. Madde Lv 1 44 pts. 9,369
  7. Avatar for TomTaylor 37. TomTaylor Lv 1 43 pts. 9,355
  8. Avatar for gcm24 38. gcm24 Lv 1 42 pts. 9,352
  9. Avatar for steveB 39. steveB Lv 1 41 pts. 9,345
  10. Avatar for dcrwheeler 40. dcrwheeler Lv 1 40 pts. 9,336

Comments

decahedron Lv 1

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep Staff Lv 1

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.