Placeholder image of a protein
Icon representing a puzzle

1183: Unsolved De-novo Freestyle 65

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 15, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 9,136
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,088
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,059
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,044
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,892
  6. Avatar for freefolder 16. freefolder 1 pt. 8,296
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,226
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,850
  9. Avatar for CureCoin 19. CureCoin 1 pt. 5,675
  1. Avatar for reefyrob 41. reefyrob Lv 1 39 pts. 9,314
  2. Avatar for Skippysk8s 42. Skippysk8s Lv 1 38 pts. 9,313
  3. Avatar for Satina 43. Satina Lv 1 37 pts. 9,312
  4. Avatar for christioanchauvin 44. christioanchauvin Lv 1 36 pts. 9,302
  5. Avatar for drumpeter18yrs9yrs 45. drumpeter18yrs9yrs Lv 1 35 pts. 9,301
  6. Avatar for crpainter 46. crpainter Lv 1 34 pts. 9,293
  7. Avatar for jobo0502 47. jobo0502 Lv 1 33 pts. 9,288
  8. Avatar for WBarme1234 48. WBarme1234 Lv 1 32 pts. 9,268
  9. Avatar for smilingone 49. smilingone Lv 1 31 pts. 9,266
  10. Avatar for nicobul 50. nicobul Lv 1 30 pts. 9,266

Comments

decahedron Lv 1

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep Staff Lv 1

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.