Placeholder image of a protein
Icon representing a puzzle

1183: Unsolved De-novo Freestyle 65

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 15, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 9,136
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,088
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,059
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,044
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,892
  6. Avatar for freefolder 16. freefolder 1 pt. 8,296
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,226
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,850
  9. Avatar for CureCoin 19. CureCoin 1 pt. 5,675
  1. Avatar for BCAA 81. BCAA Lv 1 12 pts. 9,059
  2. Avatar for Colostomy EXPLOSION. 82. Colostomy EXPLOSION. Lv 1 12 pts. 9,058
  3. Avatar for YeshuaLives 83. YeshuaLives Lv 1 11 pts. 9,054
  4. Avatar for kitek314_pl 84. kitek314_pl Lv 1 11 pts. 9,044
  5. Avatar for Mohambone 85. Mohambone Lv 1 11 pts. 9,042
  6. Avatar for hansvandenhof 86. hansvandenhof Lv 1 10 pts. 9,042
  7. Avatar for BrKapr 87. BrKapr Lv 1 10 pts. 9,041
  8. Avatar for Superphosphate 88. Superphosphate Lv 1 10 pts. 9,029
  9. Avatar for BeImmie 89. BeImmie Lv 1 9 pts. 9,020
  10. Avatar for YGK 90. YGK Lv 1 9 pts. 9,017

Comments

decahedron Lv 1

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep Staff Lv 1

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.