Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,530
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 9,238
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 9,027
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,969
  5. Avatar for freefolder 15. freefolder 1 pt. 8,735
  6. Avatar for xkcd 16. xkcd 1 pt. 8,568
  7. Avatar for Polska 17. Polska 1 pt. 7,809
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,590
  9. Avatar for Boinc.be 19. Boinc.be 1 pt. 7,428
  10. Avatar for CureCoin 20. CureCoin 1 pt. 6,917
  1. Avatar for MaartenDesnouck 91. MaartenDesnouck Lv 1 10 pts. 9,267
  2. Avatar for hallenberg 92. hallenberg Lv 1 10 pts. 9,265
  3. Avatar for BCAA 93. BCAA Lv 1 10 pts. 9,238
  4. Avatar for ecali 94. ecali Lv 1 9 pts. 9,220
  5. Avatar for Truncheon Luncheon 95. Truncheon Luncheon Lv 1 9 pts. 9,214
  6. Avatar for PrettyPony2001 96. PrettyPony2001 Lv 1 9 pts. 9,188
  7. Avatar for Soggy Doglog 97. Soggy Doglog Lv 1 8 pts. 9,182
  8. Avatar for Festering Wounds 98. Festering Wounds Lv 1 8 pts. 9,181
  9. Avatar for georg137 99. georg137 Lv 1 8 pts. 9,171
  10. Avatar for Superphosphate 100. Superphosphate Lv 1 8 pts. 9,165

Comments