Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,006
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,960
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 9,955
  4. Avatar for Contenders 4. Contenders 45 pts. 9,938
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,930
  6. Avatar for Go Science 6. Go Science 24 pts. 9,924
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 9,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 9,808
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,772
  10. Avatar for Deleted group 10. Deleted group pts. 9,703
  1. Avatar for MaartenDesnouck 91. MaartenDesnouck Lv 1 10 pts. 9,267
  2. Avatar for hallenberg 92. hallenberg Lv 1 10 pts. 9,265
  3. Avatar for BCAA 93. BCAA Lv 1 10 pts. 9,238
  4. Avatar for ecali 94. ecali Lv 1 9 pts. 9,220
  5. Avatar for Truncheon Luncheon 95. Truncheon Luncheon Lv 1 9 pts. 9,214
  6. Avatar for PrettyPony2001 96. PrettyPony2001 Lv 1 9 pts. 9,188
  7. Avatar for Soggy Doglog 97. Soggy Doglog Lv 1 8 pts. 9,182
  8. Avatar for Festering Wounds 98. Festering Wounds Lv 1 8 pts. 9,181
  9. Avatar for georg137 99. georg137 Lv 1 8 pts. 9,171
  10. Avatar for Superphosphate 100. Superphosphate Lv 1 8 pts. 9,165

Comments