Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,530
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 9,238
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 9,027
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,969
  5. Avatar for freefolder 15. freefolder 1 pt. 8,735
  6. Avatar for xkcd 16. xkcd 1 pt. 8,568
  7. Avatar for Polska 17. Polska 1 pt. 7,809
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,590
  9. Avatar for Boinc.be 19. Boinc.be 1 pt. 7,428
  10. Avatar for CureCoin 20. CureCoin 1 pt. 6,917

  1. Avatar for Pro Lapser 101. Pro Lapser Lv 1 7 pts. 9,142
  2. Avatar for Psych0Active 102. Psych0Active Lv 1 7 pts. 9,128
  3. Avatar for NameChangeNeeded01 103. NameChangeNeeded01 Lv 1 7 pts. 9,121
  4. Avatar for Ernst Zundel 104. Ernst Zundel Lv 1 7 pts. 9,117
  5. Avatar for ManVsYard 105. ManVsYard Lv 1 6 pts. 9,110
  6. Avatar for uihcv 106. uihcv Lv 1 6 pts. 9,065
  7. Avatar for arginia 107. arginia Lv 1 6 pts. 9,065
  8. Avatar for Merf 108. Merf Lv 1 6 pts. 9,038
  9. Avatar for Mr_Jolty 109. Mr_Jolty Lv 1 6 pts. 9,027
  10. Avatar for fiendish_ghoul 110. fiendish_ghoul Lv 1 5 pts. 9,024

Comments