Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Beta Folders 100 pts. 10,006
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,960
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 9,955
  4. Avatar for Contenders 4. Contenders 45 pts. 9,938
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,930
  6. Avatar for Go Science 6. Go Science 24 pts. 9,924
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 9,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 9,808
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,772
  10. Avatar for Deleted group 10. Deleted group pts. 9,703

  1. Avatar for Pro Lapser 101. Pro Lapser Lv 1 7 pts. 9,142
  2. Avatar for Psych0Active 102. Psych0Active Lv 1 7 pts. 9,128
  3. Avatar for NameChangeNeeded01 103. NameChangeNeeded01 Lv 1 7 pts. 9,121
  4. Avatar for Ernst Zundel 104. Ernst Zundel Lv 1 7 pts. 9,117
  5. Avatar for ManVsYard 105. ManVsYard Lv 1 6 pts. 9,110
  6. Avatar for uihcv 106. uihcv Lv 1 6 pts. 9,065
  7. Avatar for arginia 107. arginia Lv 1 6 pts. 9,065
  8. Avatar for Merf 108. Merf Lv 1 6 pts. 9,038
  9. Avatar for Mr_Jolty 109. Mr_Jolty Lv 1 6 pts. 9,027
  10. Avatar for fiendish_ghoul 110. fiendish_ghoul Lv 1 5 pts. 9,024

Comments