Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,530
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 9,238
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 9,027
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,969
  5. Avatar for freefolder 15. freefolder 1 pt. 8,735
  6. Avatar for xkcd 16. xkcd 1 pt. 8,568
  7. Avatar for Polska 17. Polska 1 pt. 7,809
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,590
  9. Avatar for Boinc.be 19. Boinc.be 1 pt. 7,428
  10. Avatar for CureCoin 20. CureCoin 1 pt. 6,917
  1. Avatar for pfirth 51. pfirth Lv 1 32 pts. 9,698
  2. Avatar for Crossed Sticks 52. Crossed Sticks Lv 1 31 pts. 9,689
  3. Avatar for guineapig 53. guineapig Lv 1 30 pts. 9,677
  4. Avatar for crpainter 54. crpainter Lv 1 29 pts. 9,673
  5. Avatar for Deleted player 55. Deleted player 29 pts. 9,666
  6. Avatar for hansvandenhof 56. hansvandenhof Lv 1 28 pts. 9,649
  7. Avatar for phi16 57. phi16 Lv 1 27 pts. 9,632
  8. Avatar for TomTaylor 58. TomTaylor Lv 1 26 pts. 9,631
  9. Avatar for deLaCeiba 59. deLaCeiba Lv 1 26 pts. 9,625
  10. Avatar for jamiexq 60. jamiexq Lv 1 25 pts. 9,617

Comments