Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Beta Folders 100 pts. 10,006
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,960
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 9,955
  4. Avatar for Contenders 4. Contenders 45 pts. 9,938
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,930
  6. Avatar for Go Science 6. Go Science 24 pts. 9,924
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 9,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 9,808
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,772
  10. Avatar for Deleted group 10. Deleted group pts. 9,703

  1. Avatar for pfirth 51. pfirth Lv 1 32 pts. 9,698
  2. Avatar for Crossed Sticks 52. Crossed Sticks Lv 1 31 pts. 9,689
  3. Avatar for guineapig 53. guineapig Lv 1 30 pts. 9,677
  4. Avatar for crpainter 54. crpainter Lv 1 29 pts. 9,673
  5. Avatar for Deleted player 55. Deleted player 29 pts. 9,666
  6. Avatar for hansvandenhof 56. hansvandenhof Lv 1 28 pts. 9,649
  7. Avatar for phi16 57. phi16 Lv 1 27 pts. 9,632
  8. Avatar for TomTaylor 58. TomTaylor Lv 1 26 pts. 9,631
  9. Avatar for deLaCeiba 59. deLaCeiba Lv 1 26 pts. 9,625
  10. Avatar for jamiexq 60. jamiexq Lv 1 25 pts. 9,617

Comments