Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Team China 21. Team China 1 pt. 4,730

  1. Avatar for harvardman 121. harvardman Lv 1 4 pts. 8,879
  2. Avatar for Giant Berk 122. Giant Berk Lv 1 4 pts. 8,871
  3. Avatar for fishercat 123. fishercat Lv 1 3 pts. 8,851
  4. Avatar for Simek 124. Simek Lv 1 3 pts. 8,843
  5. Avatar for andrewxc 125. andrewxc Lv 1 3 pts. 8,833
  6. Avatar for gcm24 126. gcm24 Lv 1 3 pts. 8,823
  7. Avatar for cherry39 127. cherry39 Lv 1 3 pts. 8,795
  8. Avatar for JUMELLE54 128. JUMELLE54 Lv 1 3 pts. 8,791
  9. Avatar for zo3xia2 129. zo3xia2 Lv 1 3 pts. 8,779
  10. Avatar for WBarme1234 130. WBarme1234 Lv 1 3 pts. 8,778

Comments