Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 4,730
  1. Avatar for lacie 151. lacie Lv 1 1 pt. 8,393
  2. Avatar for 01010011111 152. 01010011111 Lv 1 1 pt. 8,389
  3. Avatar for Inkedhands 153. Inkedhands Lv 1 1 pt. 8,340
  4. Avatar for mirjamvandelft 154. mirjamvandelft Lv 1 1 pt. 8,328
  5. Avatar for BioEhoes 155. BioEhoes Lv 1 1 pt. 8,299
  6. Avatar for Iron pet 156. Iron pet Lv 1 1 pt. 8,281
  7. Avatar for DScott 157. DScott Lv 1 1 pt. 8,278
  8. Avatar for bwkittitas 158. bwkittitas Lv 1 1 pt. 8,268
  9. Avatar for theoracle94 159. theoracle94 Lv 1 1 pt. 8,257
  10. Avatar for Dempy 160. Dempy Lv 1 1 pt. 8,233

Comments