Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 4,730
  1. Avatar for martinf 161. martinf Lv 1 1 pt. 8,167
  2. Avatar for jebbiek 162. jebbiek Lv 1 1 pt. 8,149
  3. Avatar for pandabearsecond 163. pandabearsecond Lv 1 1 pt. 8,147
  4. Avatar for LuapNor 164. LuapNor Lv 1 1 pt. 8,126
  5. Avatar for metafolder 165. metafolder Lv 1 1 pt. 8,123
  6. Avatar for sean4046 166. sean4046 Lv 1 1 pt. 8,109
  7. Avatar for ssingh39 167. ssingh39 Lv 1 1 pt. 8,104
  8. Avatar for marie.c 168. marie.c Lv 1 1 pt. 8,084
  9. Avatar for justjustin 169. justjustin Lv 1 1 pt. 8,049
  10. Avatar for Punktchen 170. Punktchen Lv 1 1 pt. 8,020

Comments