Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 4,730
  1. Avatar for lamoille 171. lamoille Lv 1 1 pt. 8,014
  2. Avatar for rezaefar 172. rezaefar Lv 1 1 pt. 7,972
  3. Avatar for franse 173. franse Lv 1 1 pt. 7,934
  4. Avatar for penteplayer 174. penteplayer Lv 1 1 pt. 7,891
  5. Avatar for tela 175. tela Lv 1 1 pt. 7,889
  6. Avatar for BackBuffer 176. BackBuffer Lv 1 1 pt. 7,876
  7. Avatar for leehaggis 177. leehaggis Lv 1 1 pt. 7,856
  8. Avatar for YorPrints 178. YorPrints Lv 1 1 pt. 7,837
  9. Avatar for Tomi.B 179. Tomi.B Lv 1 1 pt. 7,809
  10. Avatar for GreekCivilization 180. GreekCivilization Lv 1 1 pt. 7,802

Comments