Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 4,730
  1. Avatar for przemek112233 211. przemek112233 Lv 1 1 pt. 7,130
  2. Avatar for larry25427 212. larry25427 Lv 1 1 pt. 7,124
  3. Avatar for FreeFolder 213. FreeFolder Lv 1 1 pt. 7,121
  4. Avatar for Thebatman012 214. Thebatman012 Lv 1 1 pt. 7,113
  5. Avatar for aaron_roschke 215. aaron_roschke Lv 1 1 pt. 7,109
  6. Avatar for s-ktr 216. s-ktr Lv 1 1 pt. 6,989
  7. Avatar for Arne Heessels 217. Arne Heessels Lv 1 1 pt. 6,961
  8. Avatar for oceanic1986 218. oceanic1986 Lv 1 1 pt. 6,957
  9. Avatar for agnairt 219. agnairt Lv 1 1 pt. 6,954
  10. Avatar for Awesomeausty 220. Awesomeausty Lv 1 1 pt. 6,937

Comments