Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 4,730
  1. Avatar for smarthuman 221. smarthuman Lv 1 1 pt. 6,917
  2. Avatar for ninome 222. ninome Lv 1 1 pt. 6,908
  3. Avatar for yoonsikp 223. yoonsikp Lv 1 1 pt. 6,886
  4. Avatar for d1234575 224. d1234575 Lv 1 1 pt. 6,882
  5. Avatar for Close At Hand 225. Close At Hand Lv 1 1 pt. 6,872
  6. Avatar for Jaco van As 226. Jaco van As Lv 1 1 pt. 6,806
  7. Avatar for petetrig 227. petetrig Lv 1 1 pt. 6,638
  8. Avatar for Josselyn 228. Josselyn Lv 1 1 pt. 6,467
  9. Avatar for tsarsaltin 229. tsarsaltin Lv 1 1 pt. 6,324
  10. Avatar for Soccer3Jackson 230. Soccer3Jackson Lv 1 1 pt. 5,897

Comments