Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 4,730
  1. Avatar for jxzxwwy 231. jxzxwwy Lv 1 1 pt. 5,844
  2. Avatar for NDoughty 232. NDoughty Lv 1 1 pt. 5,036
  3. Avatar for leofoldit 233. leofoldit Lv 1 1 pt. 5,019
  4. Avatar for RobinChmelik 234. RobinChmelik Lv 1 1 pt. 4,836
  5. Avatar for Zelin 235. Zelin Lv 1 1 pt. 4,730
  6. Avatar for SaraLL 236. SaraLL Lv 1 1 pt. 4,730
  7. Avatar for AryehK 237. AryehK Lv 1 1 pt. 4,730
  8. Avatar for honzikjk 238. honzikjk Lv 1 1 pt. 4,730
  9. Avatar for Deleted player 239. Deleted player pts. 4,730
  10. Avatar for packer 240. packer Lv 1 1 pt. 4,730

Comments