Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 4,730
  1. Avatar for weitzen 21. weitzen Lv 1 65 pts. 9,813
  2. Avatar for t012 22. t012 Lv 1 64 pts. 9,811
  3. Avatar for gloverd 23. gloverd Lv 1 62 pts. 9,809
  4. Avatar for Museka 24. Museka Lv 1 61 pts. 9,808
  5. Avatar for johnmitch 25. johnmitch Lv 1 60 pts. 9,807
  6. Avatar for nicobul 26. nicobul Lv 1 58 pts. 9,804
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 57 pts. 9,789
  8. Avatar for reefyrob 28. reefyrob Lv 1 56 pts. 9,787
  9. Avatar for pmdpmd 29. pmdpmd Lv 1 54 pts. 9,785
  10. Avatar for viosca 30. viosca Lv 1 53 pts. 9,778

Comments