Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 4,730
  1. Avatar for sheerbliss 41. sheerbliss Lv 1 41 pts. 9,738
  2. Avatar for Bletchley Park 42. Bletchley Park Lv 1 40 pts. 9,734
  3. Avatar for Satina 43. Satina Lv 1 39 pts. 9,732
  4. Avatar for isaksson 44. isaksson Lv 1 38 pts. 9,724
  5. Avatar for hpaege 45. hpaege Lv 1 37 pts. 9,721
  6. Avatar for nemo7731 46. nemo7731 Lv 1 36 pts. 9,716
  7. Avatar for WarpSpeed 47. WarpSpeed Lv 1 35 pts. 9,710
  8. Avatar for Anfinsen_slept_here 48. Anfinsen_slept_here Lv 1 34 pts. 9,703
  9. Avatar for steveB 49. steveB Lv 1 33 pts. 9,703
  10. Avatar for shettler 50. shettler Lv 1 33 pts. 9,700

Comments