Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Beta Folders 100 pts. 10,006
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,960
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 9,955
  4. Avatar for Contenders 4. Contenders 45 pts. 9,938
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,930
  6. Avatar for Go Science 6. Go Science 24 pts. 9,924
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 9,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 9,808
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,772
  10. Avatar for Deleted group 10. Deleted group pts. 9,703

  1. Avatar for drumpeter18yrs9yrs 191. drumpeter18yrs9yrs Lv 1 1 pt. 7,463
  2. Avatar for andchl 192. andchl Lv 1 1 pt. 7,448
  3. Avatar for wosser1 193. wosser1 Lv 1 1 pt. 7,442
  4. Avatar for PeterBB 194. PeterBB Lv 1 1 pt. 7,439
  5. Avatar for Perzik 195. Perzik Lv 1 1 pt. 7,428
  6. Avatar for isantheautumn 196. isantheautumn Lv 1 1 pt. 7,416
  7. Avatar for cnhrcolemam 197. cnhrcolemam Lv 1 1 pt. 7,396
  8. Avatar for Cerzax 198. Cerzax Lv 1 1 pt. 7,373
  9. Avatar for walenz 199. walenz Lv 1 1 pt. 7,352
  10. Avatar for thatswave 200. thatswave Lv 1 1 pt. 7,332

Comments