Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Beta Folders 100 pts. 10,006
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,960
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 9,955
  4. Avatar for Contenders 4. Contenders 45 pts. 9,938
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,930
  6. Avatar for Go Science 6. Go Science 24 pts. 9,924
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 9,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 9,808
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,772
  10. Avatar for Deleted group 10. Deleted group pts. 9,703

  1. Avatar for jermainiac 61. jermainiac Lv 1 24 pts. 9,616
  2. Avatar for smholst 62. smholst Lv 1 24 pts. 9,605
  3. Avatar for tarimo 63. tarimo Lv 1 23 pts. 9,604
  4. Avatar for BrKapr 64. BrKapr Lv 1 22 pts. 9,604
  5. Avatar for cbwest 65. cbwest Lv 1 22 pts. 9,593
  6. Avatar for stomjoh 66. stomjoh Lv 1 21 pts. 9,585
  7. Avatar for goastano 67. goastano Lv 1 21 pts. 9,580
  8. Avatar for YeshuaLives 68. YeshuaLives Lv 1 20 pts. 9,571
  9. Avatar for kitek314_pl 69. kitek314_pl Lv 1 20 pts. 9,530
  10. Avatar for gurch 70. gurch Lv 1 19 pts. 9,523

Comments