Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820
  1. Avatar for hada 121. hada Lv 1 5 pts. 8,452
  2. Avatar for justjustin 122. justjustin Lv 1 4 pts. 8,444
  3. Avatar for leehaggis 123. leehaggis Lv 1 4 pts. 8,438
  4. Avatar for pandapharmd 124. pandapharmd Lv 1 4 pts. 8,429
  5. Avatar for ManVsYard 125. ManVsYard Lv 1 4 pts. 8,421
  6. Avatar for Punktchen 126. Punktchen Lv 1 4 pts. 8,419
  7. Avatar for Amphimixus 127. Amphimixus Lv 1 4 pts. 8,414
  8. Avatar for Psych0Active 128. Psych0Active Lv 1 4 pts. 8,410
  9. Avatar for Mr_Jolty 129. Mr_Jolty Lv 1 3 pts. 8,393
  10. Avatar for TJOK fan 130. TJOK fan Lv 1 3 pts. 8,383

Comments