Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 8,923
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 8,923
  3. Avatar for Contenders 3. Contenders 65 pts. 8,915
  4. Avatar for Go Science 4. Go Science 52 pts. 8,913
  5. Avatar for Void Crushers 5. Void Crushers 41 pts. 8,882
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 32 pts. 8,877
  7. Avatar for Gargleblasters 7. Gargleblasters 24 pts. 8,852
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,742
  9. Avatar for Deleted group 9. Deleted group pts. 8,721
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 10 pts. 8,662
  1. Avatar for hada 121. hada Lv 1 5 pts. 8,452
  2. Avatar for justjustin 122. justjustin Lv 1 4 pts. 8,444
  3. Avatar for leehaggis 123. leehaggis Lv 1 4 pts. 8,438
  4. Avatar for pandapharmd 124. pandapharmd Lv 1 4 pts. 8,429
  5. Avatar for ManVsYard 125. ManVsYard Lv 1 4 pts. 8,421
  6. Avatar for Punktchen 126. Punktchen Lv 1 4 pts. 8,419
  7. Avatar for Amphimixus 127. Amphimixus Lv 1 4 pts. 8,414
  8. Avatar for Psych0Active 128. Psych0Active Lv 1 4 pts. 8,410
  9. Avatar for Mr_Jolty 129. Mr_Jolty Lv 1 3 pts. 8,393
  10. Avatar for TJOK fan 130. TJOK fan Lv 1 3 pts. 8,383

Comments