Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820
  1. Avatar for martinf 151. martinf Lv 1 2 pts. 8,258
  2. Avatar for isantheautumn 152. isantheautumn Lv 1 2 pts. 8,225
  3. Avatar for bhodg1 153. bhodg1 Lv 1 2 pts. 8,210
  4. Avatar for Altercomp 154. Altercomp Lv 1 1 pt. 8,210
  5. Avatar for proteansoup 155. proteansoup Lv 1 1 pt. 8,194
  6. Avatar for 01010011111 156. 01010011111 Lv 1 1 pt. 8,191
  7. Avatar for NotJim99 157. NotJim99 Lv 1 1 pt. 8,191
  8. Avatar for bitwave 158. bitwave Lv 1 1 pt. 8,181
  9. Avatar for Close At Hand 159. Close At Hand Lv 1 1 pt. 8,165
  10. Avatar for BackBuffer 160. BackBuffer Lv 1 1 pt. 8,162

Comments