Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Beta Folders 100 pts. 8,923
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 8,923
  3. Avatar for Contenders 3. Contenders 65 pts. 8,915
  4. Avatar for Go Science 4. Go Science 52 pts. 8,913
  5. Avatar for Void Crushers 5. Void Crushers 41 pts. 8,882
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 32 pts. 8,877
  7. Avatar for Gargleblasters 7. Gargleblasters 24 pts. 8,852
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,742
  9. Avatar for Deleted group 9. Deleted group pts. 8,721
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 10 pts. 8,662

  1. Avatar for martinf 151. martinf Lv 1 2 pts. 8,258
  2. Avatar for isantheautumn 152. isantheautumn Lv 1 2 pts. 8,225
  3. Avatar for bhodg1 153. bhodg1 Lv 1 2 pts. 8,210
  4. Avatar for Altercomp 154. Altercomp Lv 1 1 pt. 8,210
  5. Avatar for proteansoup 155. proteansoup Lv 1 1 pt. 8,194
  6. Avatar for 01010011111 156. 01010011111 Lv 1 1 pt. 8,191
  7. Avatar for NotJim99 157. NotJim99 Lv 1 1 pt. 8,191
  8. Avatar for bitwave 158. bitwave Lv 1 1 pt. 8,181
  9. Avatar for Close At Hand 159. Close At Hand Lv 1 1 pt. 8,165
  10. Avatar for BackBuffer 160. BackBuffer Lv 1 1 pt. 8,162

Comments