Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820
  1. Avatar for marsfan 171. marsfan Lv 1 1 pt. 8,028
  2. Avatar for DrakeSnarski 172. DrakeSnarski Lv 1 1 pt. 8,018
  3. Avatar for NK Dragon Engineer 173. NK Dragon Engineer Lv 1 1 pt. 8,018
  4. Avatar for lildantipope 174. lildantipope Lv 1 1 pt. 8,008
  5. Avatar for Valuabie Pig 175. Valuabie Pig Lv 1 1 pt. 8,008
  6. Avatar for larry25427 176. larry25427 Lv 1 1 pt. 8,005
  7. Avatar for brgreening 177. brgreening Lv 1 1 pt. 7,997
  8. Avatar for Boris Blaster 178. Boris Blaster Lv 1 1 pt. 7,993
  9. Avatar for Sydefecks 179. Sydefecks Lv 1 1 pt. 7,991
  10. Avatar for sean4046 180. sean4046 Lv 1 1 pt. 7,938

Comments