Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Beta Folders 100 pts. 8,923
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 8,923
  3. Avatar for Contenders 3. Contenders 65 pts. 8,915
  4. Avatar for Go Science 4. Go Science 52 pts. 8,913
  5. Avatar for Void Crushers 5. Void Crushers 41 pts. 8,882
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 32 pts. 8,877
  7. Avatar for Gargleblasters 7. Gargleblasters 24 pts. 8,852
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,742
  9. Avatar for Deleted group 9. Deleted group pts. 8,721
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 10 pts. 8,662

  1. Avatar for marsfan 171. marsfan Lv 1 1 pt. 8,028
  2. Avatar for DrakeSnarski 172. DrakeSnarski Lv 1 1 pt. 8,018
  3. Avatar for NK Dragon Engineer 173. NK Dragon Engineer Lv 1 1 pt. 8,018
  4. Avatar for lildantipope 174. lildantipope Lv 1 1 pt. 8,008
  5. Avatar for Valuabie Pig 175. Valuabie Pig Lv 1 1 pt. 8,008
  6. Avatar for larry25427 176. larry25427 Lv 1 1 pt. 8,005
  7. Avatar for brgreening 177. brgreening Lv 1 1 pt. 7,997
  8. Avatar for Boris Blaster 178. Boris Blaster Lv 1 1 pt. 7,993
  9. Avatar for Sydefecks 179. Sydefecks Lv 1 1 pt. 7,991
  10. Avatar for sean4046 180. sean4046 Lv 1 1 pt. 7,938

Comments