Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820

  1. Avatar for 2017palvesdelima 231. 2017palvesdelima Lv 1 1 pt. 7,170
  2. Avatar for oliv.92 232. oliv.92 Lv 1 1 pt. 7,162
  3. Avatar for placid.lion 233. placid.lion Lv 1 1 pt. 7,071
  4. Avatar for doyoumath 234. doyoumath Lv 1 1 pt. 7,048
  5. Avatar for EastonSickels1234 235. EastonSickels1234 Lv 1 1 pt. 6,990
  6. Avatar for easmith7490 236. easmith7490 Lv 1 1 pt. 6,980
  7. Avatar for neelkprabhu 237. neelkprabhu Lv 1 1 pt. 6,950
  8. Avatar for Aldrovanda 238. Aldrovanda Lv 1 1 pt. 6,898
  9. Avatar for THATPOWER 239. THATPOWER Lv 1 1 pt. 6,854
  10. Avatar for serah29 240. serah29 Lv 1 1 pt. 6,243

Comments