Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for WBarme1234 101. WBarme1234 Lv 1 9 pts. 8,530
  2. Avatar for metafolder 102. metafolder Lv 1 8 pts. 8,528
  3. Avatar for harvardman 103. harvardman Lv 1 8 pts. 8,520
  4. Avatar for marie.c 104. marie.c Lv 1 8 pts. 8,507
  5. Avatar for andrewxc 105. andrewxc Lv 1 8 pts. 8,504
  6. Avatar for alwen 106. alwen Lv 1 7 pts. 8,504
  7. Avatar for ViJay7019 107. ViJay7019 Lv 1 7 pts. 8,504
  8. Avatar for Mohambone 108. Mohambone Lv 1 7 pts. 8,500
  9. Avatar for Soggy Doglog 109. Soggy Doglog Lv 1 7 pts. 8,498
  10. Avatar for Imeturoran 110. Imeturoran Lv 1 6 pts. 8,494

Comments