Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for NameChangeNeeded01 111. NameChangeNeeded01 Lv 1 6 pts. 8,494
  2. Avatar for Superphosphate 112. Superphosphate Lv 1 6 pts. 8,481
  3. Avatar for armaholik 113. armaholik Lv 1 6 pts. 8,481
  4. Avatar for DScott 114. DScott Lv 1 6 pts. 8,479
  5. Avatar for pfirth 115. pfirth Lv 1 6 pts. 8,478
  6. Avatar for Deleted player 116. Deleted player pts. 8,476
  7. Avatar for BCAA 117. BCAA Lv 1 5 pts. 8,471
  8. Avatar for jebbiek 118. jebbiek Lv 1 5 pts. 8,466
  9. Avatar for Mydogisa Toelicker 119. Mydogisa Toelicker Lv 1 5 pts. 8,465
  10. Avatar for fryguy 120. fryguy Lv 1 5 pts. 8,458

Comments