Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210

  1. Avatar for Mass788 131. Mass788 Lv 1 3 pts. 8,382
  2. Avatar for Jesse Pinkman 132. Jesse Pinkman Lv 1 3 pts. 8,375
  3. Avatar for Altejos349 133. Altejos349 Lv 1 3 pts. 8,365
  4. Avatar for Hansie 134. Hansie Lv 1 3 pts. 8,355
  5. Avatar for decbin 135. decbin Lv 1 3 pts. 8,351
  6. Avatar for senor pit 136. senor pit Lv 1 3 pts. 8,340
  7. Avatar for bendbob 137. bendbob Lv 1 3 pts. 8,336
  8. Avatar for fiendish_ghoul 138. fiendish_ghoul Lv 1 3 pts. 8,330
  9. Avatar for tela 139. tela Lv 1 2 pts. 8,330
  10. Avatar for LuapNor 140. LuapNor Lv 1 2 pts. 8,313

Comments