Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210

  1. Avatar for Greenlee 141. Greenlee Lv 1 2 pts. 8,309
  2. Avatar for navn 142. navn Lv 1 2 pts. 8,308
  3. Avatar for WarpSpeed 143. WarpSpeed Lv 1 2 pts. 8,306
  4. Avatar for YeshuaLives 144. YeshuaLives Lv 1 2 pts. 8,297
  5. Avatar for nagistick 145. nagistick Lv 1 2 pts. 8,294
  6. Avatar for Iron pet 146. Iron pet Lv 1 2 pts. 8,286
  7. Avatar for dahast.de 147. dahast.de Lv 1 2 pts. 8,285
  8. Avatar for LaoiseNiFhoghlu 148. LaoiseNiFhoghlu Lv 1 2 pts. 8,275
  9. Avatar for FreeFolder 149. FreeFolder Lv 1 2 pts. 8,271
  10. Avatar for BioEhoes 150. BioEhoes Lv 1 2 pts. 8,268

Comments