Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for Starlight36 161. Starlight36 Lv 1 1 pt. 8,161
  2. Avatar for GreekCivilization 162. GreekCivilization Lv 1 1 pt. 8,146
  3. Avatar for JCBio162 163. JCBio162 Lv 1 1 pt. 8,145
  4. Avatar for Pro Lapser 164. Pro Lapser Lv 1 1 pt. 8,144
  5. Avatar for momadoc 165. momadoc Lv 1 1 pt. 8,135
  6. Avatar for Nasalberry 166. Nasalberry Lv 1 1 pt. 8,074
  7. Avatar for AryehK 167. AryehK Lv 1 1 pt. 8,067
  8. Avatar for ImmortalAssassin 168. ImmortalAssassin Lv 1 1 pt. 8,047
  9. Avatar for chris.owens 169. chris.owens Lv 1 1 pt. 8,043
  10. Avatar for bgrassy 170. bgrassy Lv 1 1 pt. 8,029

Comments