Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for alanpufpaff 181. alanpufpaff Lv 1 1 pt. 7,933
  2. Avatar for Arne Heessels 182. Arne Heessels Lv 1 1 pt. 7,881
  3. Avatar for Maxinestpn 183. Maxinestpn Lv 1 1 pt. 7,865
  4. Avatar for Thebatman012 184. Thebatman012 Lv 1 1 pt. 7,842
  5. Avatar for gldisater 185. gldisater Lv 1 1 pt. 7,820
  6. Avatar for gmar 186. gmar Lv 1 1 pt. 7,817
  7. Avatar for bwkittitas 187. bwkittitas Lv 1 1 pt. 7,810
  8. Avatar for IHGreenman 188. IHGreenman Lv 1 1 pt. 7,790
  9. Avatar for Inkedhands 189. Inkedhands Lv 1 1 pt. 7,751
  10. Avatar for pandabearsecond 190. pandabearsecond Lv 1 1 pt. 7,722

Comments