Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for reefyrob 11. reefyrob Lv 1 82 pts. 8,875
  2. Avatar for gloverd 12. gloverd Lv 1 81 pts. 8,847
  3. Avatar for LociOiling 13. LociOiling Lv 1 79 pts. 8,846
  4. Avatar for frood66 14. frood66 Lv 1 77 pts. 8,845
  5. Avatar for dcrwheeler 15. dcrwheeler Lv 1 76 pts. 8,843
  6. Avatar for actiasluna 16. actiasluna Lv 1 74 pts. 8,842
  7. Avatar for bertro 17. bertro Lv 1 73 pts. 8,814
  8. Avatar for Crossed Sticks 18. Crossed Sticks Lv 1 71 pts. 8,814
  9. Avatar for johnmitch 19. johnmitch Lv 1 70 pts. 8,807
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 68 pts. 8,804

Comments