Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for mirjamvandelft 191. mirjamvandelft Lv 1 1 pt. 7,668
  2. Avatar for kerpowah 192. kerpowah Lv 1 1 pt. 7,665
  3. Avatar for Wheeler22 193. Wheeler22 Lv 1 1 pt. 7,663
  4. Avatar for Radeodem8 194. Radeodem8 Lv 1 1 pt. 7,596
  5. Avatar for Kikaidkmek 195. Kikaidkmek Lv 1 1 pt. 7,577
  6. Avatar for opiorfina 196. opiorfina Lv 1 1 pt. 7,576
  7. Avatar for ribosomaltrilldank 197. ribosomaltrilldank Lv 1 1 pt. 7,568
  8. Avatar for ivalnic 198. ivalnic Lv 1 1 pt. 7,568
  9. Avatar for innatan221 199. innatan221 Lv 1 1 pt. 7,533
  10. Avatar for BeckerM 200. BeckerM Lv 1 1 pt. 7,531

Comments