Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for ToxicEagleGaming 211. ToxicEagleGaming Lv 1 1 pt. 7,397
  2. Avatar for roman madala 212. roman madala Lv 1 1 pt. 7,379
  3. Avatar for Ronin-Sensei 213. Ronin-Sensei Lv 1 1 pt. 7,370
  4. Avatar for Corruption 214. Corruption Lv 1 1 pt. 7,361
  5. Avatar for Trolinsky 215. Trolinsky Lv 1 1 pt. 7,346
  6. Avatar for petetrig 216. petetrig Lv 1 1 pt. 7,341
  7. Avatar for Crunkstar 217. Crunkstar Lv 1 1 pt. 7,336
  8. Avatar for franse 218. franse Lv 1 1 pt. 7,315
  9. Avatar for affecaffe 219. affecaffe Lv 1 1 pt. 7,310
  10. Avatar for Jaco van As 220. Jaco van As Lv 1 1 pt. 7,310

Comments