Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for Michaelb1029384 221. Michaelb1029384 Lv 1 1 pt. 7,299
  2. Avatar for blagdon 222. blagdon Lv 1 1 pt. 7,281
  3. Avatar for StpPls 223. StpPls Lv 1 1 pt. 7,270
  4. Avatar for terashig 224. terashig Lv 1 1 pt. 7,268
  5. Avatar for aspadistra 225. aspadistra Lv 1 1 pt. 7,241
  6. Avatar for Swarm_of_zerg 226. Swarm_of_zerg Lv 1 1 pt. 7,239
  7. Avatar for Perzik 227. Perzik Lv 1 1 pt. 7,236
  8. Avatar for zkm 228. zkm Lv 1 1 pt. 7,232
  9. Avatar for Jocal2016 229. Jocal2016 Lv 1 1 pt. 7,222
  10. Avatar for doctaven 230. doctaven Lv 1 1 pt. 7,210

Comments