Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for jchrisp 241. jchrisp Lv 1 1 pt. 6,135
  2. Avatar for packer 242. packer Lv 1 1 pt. 5,999
  3. Avatar for Nimbus13 243. Nimbus13 Lv 1 1 pt. 5,999
  4. Avatar for MeighMeigh 244. MeighMeigh Lv 1 1 pt. 5,999
  5. Avatar for rhassunuma 245. rhassunuma Lv 1 1 pt. 5,999
  6. Avatar for greepski 246. greepski Lv 1 1 pt. 5,999
  7. Avatar for penteplayer 247. penteplayer Lv 1 1 pt. 5,999
  8. Avatar for froggs554 248. froggs554 Lv 1 1 pt. 5,999
  9. Avatar for NDoughty 249. NDoughty Lv 1 1 pt. 5,999
  10. Avatar for Mike Cassidy 250. Mike Cassidy Lv 1 1 pt. 5,999

Comments