Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for Scopper 21. Scopper Lv 1 67 pts. 8,801
  2. Avatar for cbwest 22. cbwest Lv 1 65 pts. 8,793
  3. Avatar for Deleted player 23. Deleted player pts. 8,791
  4. Avatar for viosca 24. viosca Lv 1 63 pts. 8,789
  5. Avatar for uhuuhu 25. uhuuhu Lv 1 61 pts. 8,786
  6. Avatar for steveB 26. steveB Lv 1 60 pts. 8,781
  7. Avatar for Skippysk8s 27. Skippysk8s Lv 1 59 pts. 8,781
  8. Avatar for dpmattingly 28. dpmattingly Lv 1 57 pts. 8,779
  9. Avatar for smilingone 29. smilingone Lv 1 56 pts. 8,779
  10. Avatar for Mark- 30. Mark- Lv 1 55 pts. 8,777

Comments