Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for drumpeter18yrs9yrs 61. drumpeter18yrs9yrs Lv 1 26 pts. 8,700
  2. Avatar for cherry39 62. cherry39 Lv 1 26 pts. 8,700
  3. Avatar for gurch 63. gurch Lv 1 25 pts. 8,689
  4. Avatar for shettler 64. shettler Lv 1 24 pts. 8,688
  5. Avatar for Glen B 65. Glen B Lv 1 24 pts. 8,685
  6. Avatar for caglar 66. caglar Lv 1 23 pts. 8,681
  7. Avatar for georg137 67. georg137 Lv 1 23 pts. 8,672
  8. Avatar for diamonddays 68. diamonddays Lv 1 22 pts. 8,672
  9. Avatar for jamiexq 69. jamiexq Lv 1 21 pts. 8,667
  10. Avatar for Bushman 70. Bushman Lv 1 21 pts. 8,662

Comments