Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for jobo0502 71. jobo0502 Lv 1 20 pts. 8,660
  2. Avatar for MaartenDesnouck 72. MaartenDesnouck Lv 1 20 pts. 8,657
  3. Avatar for mitarcher 73. mitarcher Lv 1 19 pts. 8,648
  4. Avatar for SKSbell 74. SKSbell Lv 1 19 pts. 8,647
  5. Avatar for t012 75. t012 Lv 1 18 pts. 8,636
  6. Avatar for rg_sar 76. rg_sar Lv 1 18 pts. 8,635
  7. Avatar for Idiotboy 77. Idiotboy Lv 1 17 pts. 8,632
  8. Avatar for hansvandenhof 78. hansvandenhof Lv 1 17 pts. 8,632
  9. Avatar for Simek 79. Simek Lv 1 16 pts. 8,624
  10. Avatar for hallenberg 80. hallenberg Lv 1 16 pts. 8,623

Comments